Solution structure of the sh3 domain of the human src-like adopter protein (slap)
PDB DOI: 10.2210/pdb2cud/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-05-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Nameki, N. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Yokoyama, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the sh3 domain of the human src-like adopter protein (slap)
Inoue, M. , Kigawa, T. , Koshiba, S. , Nameki, N. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Yokoyama, S.
Primary Citation of Related Structures: 2CUD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SRC-like-adapter | A | 79 | Homo Sapiens | GSSGSSGPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Nameki, N. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tochio, N. , Yokoyama, S.