Solution structure of the sh3 domain of the human cytoplasmic protein nck1
PDB DOI: 10.2210/pdb2cub/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-05-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tomizawa, T. , Yokoyama, S.
Solution structure of the sh3 domain of the human cytoplasmic protein nck1
Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2CUB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytoplasmic protein NCK1 | A | 88 | Homo Sapiens | GSSGSSGDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-26 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Ohnishi, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tomizawa, T. , Yokoyama, S.