Crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8
PDB DOI: 10.2210/pdb2cu6/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Thermus Thermophilus
Deposited: 2005-05-25 Deposition Author(s): Kuramitsu, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satoh, S. , Yokoyama, S.
Method: X-RAY DIFFRACTION Resolution: 2 Å
Crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8
Kuramitsu, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satoh, S. , Yokoyama, S.
Primary Citation of Related Structures: 2CU6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| dTDP-4-keto-L-rhamnose reductase-related Protein | A | 103 | Thermus Thermophilus | MTARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGWG |
| dTDP-4-keto-L-rhamnose reductase-related Protein | B | 103 | Thermus Thermophilus | MTARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGWG |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-05-25 Deposition Author(s): Kuramitsu, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satoh, S. , Yokoyama, S.