Crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8
PDB DOI: 10.2210/pdb2cu5/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Thermus Thermophilus
Deposited: 2005-05-25 Deposition Author(s): Kuramitsu, S. , Nakagawa, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satoh, S. , Yokoyama, S.
Crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8
Kuramitsu, S. , Nakagawa, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satoh, S. , Yokoyama, S.
Primary Citation of Related Structures: 2CU5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Conserved Hypothetical Protein TT1486 | A | 129 | Thermus Thermophilus | MEGVVRLEVPTPEEGFVNITRKVEAALSGHTGLVYLFVPHTTCGLTVQEGADPTVAQDLLGRLAELAPRHRPQDRHLEGNSHAHLKSLLTGVHLLLLAEKGRLRLGRWQQVFLAEFDGPRVREVWVRLL |
| Conserved Hypothetical Protein TT1486 | B | 129 | Thermus Thermophilus | MEGVVRLEVPTPEEGFVNITRKVEAALSGHTGLVYLFVPHTTCGLTVQEGADPTVAQDLLGRLAELAPRHRPQDRHLEGNSHAHLKSLLTGVHLLLLAEKGRLRLGRWQQVFLAEFDGPRVREVWVRLL |
| Conserved Hypothetical Protein TT1486 | C | 129 | Thermus Thermophilus | MEGVVRLEVPTPEEGFVNITRKVEAALSGHTGLVYLFVPHTTCGLTVQEGADPTVAQDLLGRLAELAPRHRPQDRHLEGNSHAHLKSLLTGVHLLLLAEKGRLRLGRWQQVFLAEFDGPRVREVWVRLL |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-05-25 Deposition Author(s): Kuramitsu, S. , Nakagawa, N. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Satoh, S. , Yokoyama, S.