Solution structure of the hmg box like domain from human hypothetical protein flj14904
PDB DOI: 10.2210/pdb2cto/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2005-05-24 Deposition Author(s): Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tomizawa, T. , Yokoyama, S.
Solution structure of the hmg box like domain from human hypothetical protein flj14904
Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 2CTO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| novel protein | A | 93 | Homo Sapiens | GSSGSSGMPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSSDWALLREEEKEKYAEMAREWRAAQGKDPGPSEKQKPVFTSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-24 Deposition Author(s): Inoue, M. , Kamatari, Y.O. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Sato, M. , Tomizawa, T. , Yokoyama, S.