Solution structure of the sh2 domain of human hsh2d protein
PDB DOI: 10.2210/pdb2cs0/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-05-20 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Solution structure of the sh2 domain of human hsh2d protein
Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2CS0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hematopoietic SH2 domain containing | A | 119 | Homo Sapiens | GSSGSSGGQLAQDGVPEWFHGAISREDAENLLESQPLGSFLIRVSHSHVGYTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLDALVTFHQQKPIEPRRELLTQPCRQKDSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-20 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.