Solution structure of the fifth ig-like domain of human kin of irre like 3
PDB DOI: 10.2210/pdb2cry/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2005-05-20 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Solution structure of the fifth ig-like domain of human kin of irre like 3
Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2CRY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kin of IRRE-like protein 3 | A | 122 | Homo Sapiens | GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-20 Deposition Author(s): Hayashi, F. , Kurosaki, C. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.