Solution structure of the hmg domain of mouse hmg domain protein hmgx2
PDB DOI: 10.2210/pdb2crj/pdb
Classification: GENE REGULATION Organism(s): Mus Musculus
Deposited: 2005-05-20 Deposition Author(s): Endo, H. , Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Solution structure of the hmg domain of mouse hmg domain protein hmgx2
Endo, H. , Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2CRJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related | A | 92 | Mus Musculus | GSSGSSGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTESGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-20 Deposition Author(s): Endo, H. , Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.