Solution structure of the first ig-like domain of human fibroblast growth factor receptor 1
PDB DOI: 10.2210/pdb2cr3/pdb
Classification: CYTOKINE Organism(s): Homo Sapiens
Deposited: 2005-05-20 Deposition Author(s): Hatta, R. , Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Solution structure of the first ig-like domain of human fibroblast growth factor receptor 1
Hatta, R. , Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 2CR3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Basic fibroblast growth factor receptor 1 | A | 99 | Homo Sapiens | GSSGSSGVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-20 Deposition Author(s): Hatta, R. , Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Yoshida, M.