Solution structure of the s4 domain of u3 small nucleolar ribonucleoprotein protein imp3 homolog
PDB DOI: 10.2210/pdb2cqj/pdb
Classification: RNA BINDING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2005-05-20 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.
Solution structure of the s4 domain of u3 small nucleolar ribonucleoprotein protein imp3 homolog
Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.
Primary Citation of Related Structures: 2CQJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
U3 small nucleolar ribonucleoprotein protein IMP3 homolog | A | 71 | Salmonella Enterica | GSSGSSGRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKISGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-20 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Suzuki, S. , Terada, T. , Yokoyama, S.