Solution structure of rna binding domain 3 in cug triplet repeat rna-binding protein 1
PDB DOI: 10.2210/pdb2cpz/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2005-05-19 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Solution structure of rna binding domain 3 in cug triplet repeat rna-binding protein 1
Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.
Primary Citation of Related Structures: 2CPZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CUG triplet repeat RNA-binding protein 1 | A | 115 | Homo Sapiens | GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-19 Deposition Author(s): Inoue, M. , Kigawa, T. , Muto, Y. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Shirouzu, M. , Terada, T. , Tsuda, K. , Yokoyama, S.