Solution structure of the e3_binding domain of dihydrolipoamide branched chaintransacylase
PDB DOI: 10.2210/pdb2coo/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2005-05-18 Deposition Author(s): Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the e3_binding domain of dihydrolipoamide branched chaintransacylase
Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.
Primary Citation of Related Structures: 2COO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial | A | 70 | Homo Sapiens | GSSGSSGHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-18 Deposition Author(s): Hayashi, F. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Yokoyama, S. , Zhang, H.P.