Solution structure of the c-terminal ph domain of hypothetical protein kiaa1914 from human
PDB DOI: 10.2210/pdb2cof/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2005-05-17 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Solution structure of the c-terminal ph domain of hypothetical protein kiaa1914 from human
Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Primary Citation of Related Structures: 2COF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein KIAA1914 | A | 107 | Homo Sapiens | GSSGSSGLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-17 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.