Solution structure of the ph domain of protein kinase c, d2 type from human
PDB DOI: 10.2210/pdb2coa/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-05-17 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Solution structure of the ph domain of protein kinase c, d2 type from human
Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.
Primary Citation of Related Structures: 2COA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein kinase C, D2 type | A | 125 | Homo Sapiens | GSSGSSGTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQALMSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-17 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Li, H. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Saito, K. , Yokoyama, S.