Nmr studies on the interaction of insulin-growth factor ii (igf-ii) with igf2r domain 11
PDB DOI: 10.2210/pdb2cnj/pdb
Classification: RECEPTOR Organism(s): Homo Sapiens
Deposited: 2006-05-22 Deposition Author(s): Crosby, J. , Crump, M. , Hassan, A.B. , Prince, S. , Williams, C. , Zaccheo, O.
Nmr studies on the interaction of insulin-growth factor ii (igf-ii) with igf2r domain 11
Crosby, J. , Crump, M. , Hassan, A.B. , Prince, S. , Williams, C. , Zaccheo, O.
Primary Citation of Related Structures: 2CNJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR | D | 151 | Homo Sapiens | MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQATKEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2006-05-22 Deposition Author(s): Crosby, J. , Crump, M. , Hassan, A.B. , Prince, S. , Williams, C. , Zaccheo, O.