Crystal structure of human cytosolic 5'-nucleotidase iii (nt5c3)
PDB DOI: 10.2210/pdb2cn1/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2006-05-17 Deposition Author(s): Arrowsmith, C. , Berglund, H. , Collins, R. , Edwards, A. , Ehn, M. , Flodin, S. , Flores, A. , Graslund, S. , Hallberg, B.M. , Hammarstrom, M. , Hogbom, M. , Holmberg Schiavone, L. , Kotenyova, T. , Magnusdottir, A. , Nilsson-Ehle, P. , Nordlund, P. , Nyman, T. , Ogg, D. , Persson, C. , Sagemark, J. , Stenmark, P. , Sundstrom, M. , Thorsell, A.G. , Uppenberg, J. , Van Den Berg, S. , Wallden, K. , Weigelt, J. , Welin, M.
Crystal structure of human cytosolic 5'-nucleotidase iii (nt5c3)
Arrowsmith, C. , Berglund, H. , Collins, R. , Edwards, A. , Ehn, M. , Flodin, S. , Flores, A. , Graslund, S. , Hallberg, B.M. , Hammarstrom, M. , Hogbom, M. , Holmberg Schiavone, L. , Kotenyova, T. , Magnusdottir, A. , Nilsson-Ehle, P. , Nordlund, P. , Nyman, T. , Ogg, D. , Persson, C. , Sagemark, J. , Stenmark, P. , Sundstrom, M. , Thorsell, A.G. , Uppenberg, J. , Van Den Berg, S. , Wallden, K. , Weigelt, J. , Welin, M.
Primary Citation of Related Structures: 2CN1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
CYTOSOLIC 5'-NUCLEOTIDASE III | A | 292 | Homo Sapiens | MGSSHHHHHHSSGLVPRGSNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-05-17 Deposition Author(s): Arrowsmith, C. , Berglund, H. , Collins, R. , Edwards, A. , Ehn, M. , Flodin, S. , Flores, A. , Graslund, S. , Hallberg, B.M. , Hammarstrom, M. , Hogbom, M. , Holmberg Schiavone, L. , Kotenyova, T. , Magnusdottir, A. , Nilsson-Ehle, P. , Nordlund, P. , Nyman, T. , Ogg, D. , Persson, C. , Sagemark, J. , Stenmark, P. , Sundstrom, M. , Thorsell, A.G. , Uppenberg, J. , Van Den Berg, S. , Wallden, K. , Weigelt, J. , Welin, M.