Structure of the michaelis complex of a family 26 lichenase
PDB DOI: 10.2210/pdb2cip/pdb
Classification: HYDROLASE Organism(s): Clostridium Thermocellum
Deposited: 2006-03-24 Deposition Author(s): Davies, G.J. , Gilbert, H.J. , Money, V.A. , Scaffidi, A. , Smith, N.L. , Stick, R.V.
Structure of the michaelis complex of a family 26 lichenase
Davies, G.J. , Gilbert, H.J. , Money, V.A. , Scaffidi, A. , Smith, N.L. , Stick, R.V.
Primary Citation of Related Structures: 2CIP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ENDOGLUCANASE H | A | 282 | Clostridium Thermocellum | MASNYNSGLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPIIIAQFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGA |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-03-24 Deposition Author(s): Davies, G.J. , Gilbert, H.J. , Money, V.A. , Scaffidi, A. , Smith, N.L. , Stick, R.V.