The hydrolase domain of human 10-fthfd in complex with 6- formyltetrahydropterin
PDB DOI: 10.2210/pdb2cfi/pdb
Classification: OXIDOREDUCTASE Organism(s): Homo Sapiens
Deposited: 2006-02-21 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Ehn, M. , Graslund, S. , Hallberg, M. , Hammarstrom, M. , Kotenyova, T. , Kursula, P. , Nilsson-Ehle, P. , Nordlund, P. , Ogg, D.J. , Persson, C. , Sagemark, J. , Schuler, H. , Stenmark, P. , Sundstrom, M. , Thorsell, A. , Weigelt, J.
The hydrolase domain of human 10-fthfd in complex with 6- formyltetrahydropterin
Arrowsmith, C. , Edwards, A. , Ehn, M. , Graslund, S. , Hallberg, M. , Hammarstrom, M. , Kotenyova, T. , Kursula, P. , Nilsson-Ehle, P. , Nordlund, P. , Ogg, D.J. , Persson, C. , Sagemark, J. , Schuler, H. , Stenmark, P. , Sundstrom, M. , Thorsell, A. , Weigelt, J.
Primary Citation of Related Structures: 2CFI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 10-FORMYLTETRAHYDROFOLATE DEHYDROGENASE | A | 329 | Homo Sapiens | MHHHHHHSSGVDLGTENLYFQSMKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWRAKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMILASNFFK |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-02-21 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Ehn, M. , Graslund, S. , Hallberg, M. , Hammarstrom, M. , Kotenyova, T. , Kursula, P. , Nilsson-Ehle, P. , Nordlund, P. , Ogg, D.J. , Persson, C. , Sagemark, J. , Schuler, H. , Stenmark, P. , Sundstrom, M. , Thorsell, A. , Weigelt, J.