Structure of the epstein-barr virus zebra protein
PDB DOI: 10.2210/pdb2c9l/pdb
Classification: VIRAL PROTEIN Organism(s): Plesiomonas Shigelloides , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-12-13 Deposition Author(s): Artero, J.B. , Baudin, F. , Morand, P. , Moulin, M. , Muller, C.W. , Petosa, C.
Structure of the epstein-barr virus zebra protein
Artero, J.B. , Baudin, F. , Morand, P. , Moulin, M. , Muller, C.W. , Petosa, C.
Primary Citation of Related Structures: 2C9L
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
BZLF1 TRANS-ACTIVATOR PROTEIN | Y | 63 | Plesiomonas Shigelloides , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
BZLF1 TRANS-ACTIVATOR PROTEIN | Z | 63 | Plesiomonas Shigelloides , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-12-13 Deposition Author(s): Artero, J.B. , Baudin, F. , Morand, P. , Moulin, M. , Muller, C.W. , Petosa, C.