2BN5
P-element somatic inhibitor protein complex with u1-70k proline-rich peptide
PDB DOI: 10.2210/pdb2bn5/pdb
Classification: NUCLEAR PROTEIN Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2005-03-21 Deposition Author(s): Butler, P.J.G. , Ignjatovic, T. , Nagai, K. , Neuhaus, D. , Yang, J.-C.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
P-element somatic inhibitor protein complex with u1-70k proline-rich peptide
Butler, P.J.G. , Ignjatovic, T. , Nagai, K. , Neuhaus, D. , Yang, J.-C.
Primary Citation of Related Structures: 2BN5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PSI | A | 33 | Drosophila Melanogaster , Synthetic Construct | GADYSAQWAEYYRSVGKIEEAEAIEKTLKNKQN |
| U1 SMALL NUCLEAR RIBONUCLEOPROTEIN 70 KDA | B | 21 | Drosophila Melanogaster , Synthetic Construct | RPPPAHHNMFSVPPPPILGRG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-03-21 Deposition Author(s): Butler, P.J.G. , Ignjatovic, T. , Nagai, K. , Neuhaus, D. , Yang, J.-C.