The zinc finger domain of mengovirus leader polypeptide
PDB DOI: 10.2210/pdb2bai/pdb
Classification: VIRAL PROTEIN Organism(s): Caldicellulosiruptor Bescii (Strain Atcc Baa-1888 / Dsm 6725 / Z-1320)
Deposited: 2005-10-14 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Cornilescu, C.C. , Lee, M.S. , Markley, J.L. , Palmenberg, A.C. , Porter, F.W. , Qin, Z.
The zinc finger domain of mengovirus leader polypeptide
Center For Eukaryotic Structural Genomics (Cesg) , Cornilescu, C.C. , Lee, M.S. , Markley, J.L. , Palmenberg, A.C. , Porter, F.W. , Qin, Z.
Primary Citation of Related Structures: 2BAI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Genome polyprotein | A | 32 | Caldicellulosiruptor Bescii (Strain Atcc Baa-1888 / Dsm 6725 / Z-1320) | MATTMEQEICAHSMTFEECPKCSALQYRNGFY |
Method: SOLUTION NMR
Deposited Date: 2005-10-14 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Cornilescu, C.C. , Lee, M.S. , Markley, J.L. , Palmenberg, A.C. , Porter, F.W. , Qin, Z.