The zinc finger domain of mengovirus leader polypeptide
PDB DOI: 10.2210/pdb2bai/pdb
Classification: VIRAL PROTEIN Organism(s): Mengo Virus
Deposited: 2005-10-14 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Cornilescu, C.C. , Lee, M.S. , Markley, J.L. , Palmenberg, A.C. , Porter, F.W. , Qin, Z.
Method: SOLUTION NMR Resolution: N.A.
The zinc finger domain of mengovirus leader polypeptide
Center For Eukaryotic Structural Genomics (Cesg) , Cornilescu, C.C. , Lee, M.S. , Markley, J.L. , Palmenberg, A.C. , Porter, F.W. , Qin, Z.
Primary Citation of Related Structures: 2BAI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Genome polyprotein | A | 32 | Mengo Virus | MATTMEQEICAHSMTFEECPKCSALQYRNGFY |
Method: SOLUTION NMR
Deposited Date: 2005-10-14 Deposition Author(s): Center For Eukaryotic Structural Genomics (Cesg) , Cornilescu, C.C. , Lee, M.S. , Markley, J.L. , Palmenberg, A.C. , Porter, F.W. , Qin, Z.