Nmr structure of nika n-terminal fragment
PDB DOI: 10.2210/pdb2ba3/pdb
Classification: DNA BINDING PROTEIN Organism(s): Plasmid R64
Deposited: 2005-10-14 Deposition Author(s): Furuya, N. , Guntert, P. , Kainosho, M. , Komano, T. , Lin, Y.J. , Yoshida, H.
Nmr structure of nika n-terminal fragment
Furuya, N. , Guntert, P. , Kainosho, M. , Komano, T. , Lin, Y.J. , Yoshida, H.
Primary Citation of Related Structures: 2BA3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NikA | A | 51 | Plasmid R64 | SDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALN |
| NikA | B | 51 | Plasmid R64 | SDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALN |
Method: SOLUTION NMR
Deposited Date: 2005-10-14 Deposition Author(s): Furuya, N. , Guntert, P. , Kainosho, M. , Komano, T. , Lin, Y.J. , Yoshida, H.