2B4N
Solution structure of glucose-dependent insulinotropic polypeptide
PDB DOI: 10.2210/pdb2b4n/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): Homo Sapiens
Deposited: 2005-09-26 Deposition Author(s): Alana, I. , Hewage, C.M. , Malthouse, J.P.G. , O'Harte, F.P.M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of glucose-dependent insulinotropic polypeptide
Alana, I. , Hewage, C.M. , Malthouse, J.P.G. , O'Harte, F.P.M.
Primary Citation of Related Structures: 2B4N
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gastric inhibitory polypeptide | A | 42 | Homo Sapiens | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-09-26 Deposition Author(s): Alana, I. , Hewage, C.M. , Malthouse, J.P.G. , O'Harte, F.P.M.