Crystal structure of a response regulator receiver domain protein (bh3024) from bacillus halodurans c-125 at 2.42 a resolution
PDB DOI: 10.2210/pdb2b4a/pdb
Classification: SIGNALING PROTEIN Organism(s): Bacillus Halodurans
Deposited: 2005-09-23 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)
Crystal structure of a response regulator receiver domain protein (bh3024) from bacillus halodurans c-125 at 2.42 a resolution
Joint Center For Structural Genomics (Jcsg)
Primary Citation of Related Structures: 2B4A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BH3024 | A | 138 | Bacillus Halodurans | MGSDKIHHHHHHMQPFRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRSQLSTCDLLIVSDQLVDLSIFSLLDIVKEQTKQPSVLILTTGRHELIESSEHNLSYLQKPFAISELRAAIDYHKPSMGVTMNV |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-09-23 Deposition Author(s): Joint Center For Structural Genomics (Jcsg)