Solution structure of mammalian tachykinin peptide, neuropeptide k
PDB DOI: 10.2210/pdb2b19/pdb
Classification: NEUROPEPTIDE Organism(s): N.A.
Deposited: 2005-09-15 Deposition Author(s): Cowsik, S.M. , Dike, A.
Solution structure of mammalian tachykinin peptide, neuropeptide k
Primary Citation of Related Structures: 2B19
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Neuropeptide K | A | 36 | N.A. | DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM |
Method: SOLUTION NMR
Deposited Date: 2005-09-15 Deposition Author(s): Cowsik, S.M. , Dike, A.