Crystal structure of porcine pancreatic phospholipase a2 in complex with taurochenodeoxycholate
PDB DOI: 10.2210/pdb2b03/pdb
Classification: HYDROLASE Organism(s): Sus Scrofa
Deposited: 2005-09-12 Deposition Author(s): Bahnson, B.J. , Jain, M.K. , Pan, Y.H.
Crystal structure of porcine pancreatic phospholipase a2 in complex with taurochenodeoxycholate
Bahnson, B.J. , Jain, M.K. , Pan, Y.H.
Primary Citation of Related Structures: 2B03
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Phospholipase A2, major isoenzyme | A | 124 | Sus Scrofa | ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNTEITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-09-12 Deposition Author(s): Bahnson, B.J. , Jain, M.K. , Pan, Y.H.