Solution structure of 50s ribosomal protein l40e from sulfolobus solfataricus
PDB DOI: 10.2210/pdb2ayj/pdb
Classification: TRANSLATION Organism(s): Sulfolobus Solfataricus
Deposited: 2005-09-07 Deposition Author(s): Arrowsmith, C.H. , Edward, A. , Kennedy, M. , Lemak, A. , Lukin, J. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T. , Semesi, A. , Wu, B. , Yee, A.
Solution structure of 50s ribosomal protein l40e from sulfolobus solfataricus
Arrowsmith, C.H. , Edward, A. , Kennedy, M. , Lemak, A. , Lukin, J. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T. , Semesi, A. , Wu, B. , Yee, A.
Primary Citation of Related Structures: 2AYJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
50S ribosomal protein L40e | A | 56 | Sulfolobus Solfataricus | MPLTDPAKLQIVQQRVFLKKVCRKCGALNPIRATKCRRCHSTNLRLKKKELPTKKG |
Method: SOLUTION NMR
Deposited Date: 2005-09-07 Deposition Author(s): Arrowsmith, C.H. , Edward, A. , Kennedy, M. , Lemak, A. , Lukin, J. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T. , Semesi, A. , Wu, B. , Yee, A.