Crystal structure of hpv6a e2 dna binding domain bound to an 18 base pair dna target
PDB DOI: 10.2210/pdb2ayg/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Palicourea Condensata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-09-07 Deposition Author(s): Brady, R.L. , Gaston, K. , Hooley, E.
Crystal structure of hpv6a e2 dna binding domain bound to an 18 base pair dna target
Brady, R.L. , Gaston, K. , Hooley, E.
Primary Citation of Related Structures: 2AYG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Regulatory protein E2 | A | 87 | Palicourea Condensata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSMHLL |
Regulatory protein E2 | B | 87 | Palicourea Condensata , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSMHLL |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-09-07 Deposition Author(s): Brady, R.L. , Gaston, K. , Hooley, E.