Crystal structure of kh1 domain of human poly(c)-binding protein-2 with c-rich strand of human telomeric dna
PDB DOI: 10.2210/pdb2axy/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-09-06 Deposition Author(s): Du, Z. , James, T.L. , Lee, J.K. , Li, S. , Stroud, R.M. , Tjhen, R.J.
Crystal structure of kh1 domain of human poly(c)-binding protein-2 with c-rich strand of human telomeric dna
Du, Z. , James, T.L. , Lee, J.K. , Li, S. , Stroud, R.M. , Tjhen, R.J.
Primary Citation of Related Structures: 2AXY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Poly(rC)-binding protein 2 | A | 73 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEED |
Poly(rC)-binding protein 2 | B | 73 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEED |
Poly(rC)-binding protein 2 | C | 73 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEED |
Poly(rC)-binding protein 2 | D | 73 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEED |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-09-06 Deposition Author(s): Du, Z. , James, T.L. , Lee, J.K. , Li, S. , Stroud, R.M. , Tjhen, R.J.