Solution structure of micelle-bound fusion domain of hiv-1 gp41
PDB DOI: 10.2210/pdb2ari/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2005-08-19 Deposition Author(s): Bax, A. , Blumenthal, R. , Jaroniec, C.P. , Kaufman, J.D. , Stahl, S.J. , Viard, M. , Wingfield, P.T.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of micelle-bound fusion domain of hiv-1 gp41
Bax, A. , Blumenthal, R. , Jaroniec, C.P. , Kaufman, J.D. , Stahl, S.J. , Viard, M. , Wingfield, P.T.
Primary Citation of Related Structures: 2ARI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Envelope polyprotein GP160 | A | 39 | Human Immunodeficiency Virus 1 | PAVGIGALFLGFLGAAGSTMGAASMTLTVQADYKDDDDK |
Method: SOLUTION NMR
Deposited Date: 2005-08-19 Deposition Author(s): Bax, A. , Blumenthal, R. , Jaroniec, C.P. , Kaufman, J.D. , Stahl, S.J. , Viard, M. , Wingfield, P.T.