X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution
PDB DOI: 10.2210/pdb2aq6/pdb
Classification: OXIDOREDUCTASE Organism(s): Mycobacterium Tuberculosis
Deposited: 2005-08-17 Deposition Author(s): Biswal, B.K. , Cherney, M.M. , Garen, C. , James, M.N. , Tb Structural Genomics Consortium (Tbsgc) , Wang, M.
X-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution
Biswal, B.K. , Cherney, M.M. , Garen, C. , James, M.N. , Tb Structural Genomics Consortium (Tbsgc) , Wang, M.
Primary Citation of Related Structures: 2AQ6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PYRIDOXINE 5'-PHOSPHATE OXIDASE | A | 147 | Mycobacterium Tuberculosis | MARQVFDDKLLAVISGNSIGVLATIKHDGRPQLSNVQYHFDPRKLLIQVSIAEPRAKTRNLRRDPRASILVDADDGWSYAVAEGTAQLTPPAAAPDDDTVEALIALYRNIAGEHSDWDDYRQAMVTDRRVLLTLPISHVYGLPPGMR |
| PYRIDOXINE 5'-PHOSPHATE OXIDASE | B | 147 | Mycobacterium Tuberculosis | MARQVFDDKLLAVISGNSIGVLATIKHDGRPQLSNVQYHFDPRKLLIQVSIAEPRAKTRNLRRDPRASILVDADDGWSYAVAEGTAQLTPPAAAPDDDTVEALIALYRNIAGEHSDWDDYRQAMVTDRRVLLTLPISHVYGLPPGMR |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-08-17 Deposition Author(s): Biswal, B.K. , Cherney, M.M. , Garen, C. , James, M.N. , Tb Structural Genomics Consortium (Tbsgc) , Wang, M.