The 2.07 angstrom crystal structure of mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
PDB DOI: 10.2210/pdb2ao2/pdb
Classification: ISOMERASE Organism(s): Mycobacterium Tuberculosis
Deposited: 2005-08-12 Deposition Author(s): Aruna, B. , Hasnain, S.E. , Mande, S.C. , Prakash, P. , Qamra, R. , Tb Structural Genomics Consortium (Tbsgc)
The 2.07 angstrom crystal structure of mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
Aruna, B. , Hasnain, S.E. , Mande, S.C. , Prakash, P. , Qamra, R. , Tb Structural Genomics Consortium (Tbsgc)
Primary Citation of Related Structures: 2AO2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chorismate mutase | A | 165 | Mycobacterium Tuberculosis | GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA |
| Chorismate mutase | B | 165 | Mycobacterium Tuberculosis | GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA |
| Chorismate mutase | C | 165 | Mycobacterium Tuberculosis | GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-08-12 Deposition Author(s): Aruna, B. , Hasnain, S.E. , Mande, S.C. , Prakash, P. , Qamra, R. , Tb Structural Genomics Consortium (Tbsgc)