Solution structure and backbone dynamics of an n-terminal ubiquitin-like domain in the glut4-tethering protein, tug
PDB DOI: 10.2210/pdb2al3/pdb
Classification: ENDOCYTOSIS/EXOCYTOSIS Organism(s): Mus Musculus
Deposited: 2005-08-04 Deposition Author(s): Bogan, J.S. , Hodsdon, M.E. , Tettamanzi, M.C. , Yu, C.
Method: SOLUTION NMR Resolution: N.A.
Solution structure and backbone dynamics of an n-terminal ubiquitin-like domain in the glut4-tethering protein, tug
Bogan, J.S. , Hodsdon, M.E. , Tettamanzi, M.C. , Yu, C.
Primary Citation of Related Structures: 2AL3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TUG long isoform | A | 90 | Mus Musculus | MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVPVSRSREGPEN |
Method: SOLUTION NMR
Deposited Date: 2005-08-04 Deposition Author(s): Bogan, J.S. , Hodsdon, M.E. , Tettamanzi, M.C. , Yu, C.