Beta pix-sh3 complexed with a cbl-b peptide
PDB DOI: 10.2210/pdb2ak5/pdb
Classification: ENDOCYTOSIS/EXOCYTOSIS Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2005-08-03 Deposition Author(s): Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Groemping, Y. , Hoeller, D. , Jozic, D. , Moncalian, G. , Rittinger, K.
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Beta pix-sh3 complexed with a cbl-b peptide
Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Groemping, Y. , Hoeller, D. , Jozic, D. , Moncalian, G. , Rittinger, K.
Primary Citation of Related Structures: 2AK5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rho guanine nucleotide exchange factor 7 | A | 64 | Rattus Norvegicus , Synthetic Construct | GSANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPS |
| Rho guanine nucleotide exchange factor 7 | B | 64 | Rattus Norvegicus , Synthetic Construct | GSANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPS |
| 8-residue peptide from a signal transduction protein CBL-B | D | 8 | Rattus Norvegicus , Synthetic Construct | RPPKPRPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-08-03 Deposition Author(s): Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Groemping, Y. , Hoeller, D. , Jozic, D. , Moncalian, G. , Rittinger, K.