Beta pix-sh3 complexed with a cbl-b peptide
PDB DOI: 10.2210/pdb2ak5/pdb
Classification: ENDOCYTOSIS/EXOCYTOSIS Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2005-08-03 Deposition Author(s): Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Groemping, Y. , Hoeller, D. , Jozic, D. , Moncalian, G. , Rittinger, K.
Beta pix-sh3 complexed with a cbl-b peptide
Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Groemping, Y. , Hoeller, D. , Jozic, D. , Moncalian, G. , Rittinger, K.
Primary Citation of Related Structures: 2AK5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Rho guanine nucleotide exchange factor 7 | A | 64 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPS |
Rho guanine nucleotide exchange factor 7 | B | 64 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPS |
8-residue peptide from a signal transduction protein CBL-B | D | 8 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RPPKPRPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-08-03 Deposition Author(s): Bravo, J. , Cardenes, N. , Deribe, Y.L. , Dikic, I. , Groemping, Y. , Hoeller, D. , Jozic, D. , Moncalian, G. , Rittinger, K.