Crystal structure of benzamidine-inhibited protein c activator from the venom of copperhead snake agkistrodon contortrix contortrix
PDB DOI: 10.2210/pdb2aiq/pdb
Classification: HYDROLASE Organism(s): Agkistrodon Contortrix Contortrix
Deposited: 2005-07-30 Deposition Author(s): Arni, R.K. , Murakami, M.T.
Crystal structure of benzamidine-inhibited protein c activator from the venom of copperhead snake agkistrodon contortrix contortrix
Primary Citation of Related Structures: 2AIQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein C activator | A | 231 | Agkistrodon Contortrix Contortrix | VIGGDECNINEHRFLALVYANGSLCGGTLINQEWVLTARHCDRGNMRIYLGMHNLKVLNKDALRRFPKEKYFCLNTRNDTIWDKDIMLIRLNRPVRNSAHIAPLSLPSNPPSVGSVCRIMGWGTITSPNATLPDVPHCANINILDYAVCQAAYKGLAATTLCAGILEGGKDTCKGDSGGPLICNGQFQGILSVGGNPCAQPRKPGIYTKVFDYTDWIQSIISGNTDATCPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-07-30 Deposition Author(s): Arni, R.K. , Murakami, M.T.