2AIH
1h-nmr solution structure of a trypsin/chymotrypsin bowman-birk inhibitor from lens culinaris.
PDB DOI: 10.2210/pdb2aih/pdb
Classification: HYDROLASE Organism(s): Methylorubrum Extorquens Cm4
Deposited: 2005-07-29 Deposition Author(s): Consonni, A. , Duranti, M. , Galbusera, V. , Negri, A. , Ragg, E.M. , Scarafoni, A. , Sessa, F. , Tedeschi, G.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
1h-nmr solution structure of a trypsin/chymotrypsin bowman-birk inhibitor from lens culinaris.
Consonni, A. , Duranti, M. , Galbusera, V. , Negri, A. , Ragg, E.M. , Scarafoni, A. , Sessa, F. , Tedeschi, G.
Primary Citation of Related Structures: 2AIH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bowman-Birk type protease inhibitor, LCTI | A | 67 | Methylorubrum Extorquens Cm4 | GDDVKSACCDTCLCTRSQPPTCRCVDVRESCHSACDKCVCAYSNPPQCQCYDTHKFCYKACHNSEIE |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2005-07-29 Deposition Author(s): Consonni, A. , Duranti, M. , Galbusera, V. , Negri, A. , Ragg, E.M. , Scarafoni, A. , Sessa, F. , Tedeschi, G.