Solution structure of the joined ph domain of alpha1-syntrophin
PDB DOI: 10.2210/pdb2adz/pdb
Classification: PROTEIN BINDING Organism(s): Mus Musculus
Deposited: 2005-07-21 Deposition Author(s): Adams, M.E. , Froehner, S.C. , Long, J.F. , Wen, W. , Xu, W. , Yan, J. , Zhang, M.
Solution structure of the joined ph domain of alpha1-syntrophin
Adams, M.E. , Froehner, S.C. , Long, J.F. , Wen, W. , Xu, W. , Yan, J. , Zhang, M.
Primary Citation of Related Structures: 2ADZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alpha-1-syntrophin | A | 178 | Mus Musculus | ASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQREVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGT |
Method: SOLUTION NMR
Deposited Date: 2005-07-21 Deposition Author(s): Adams, M.E. , Froehner, S.C. , Long, J.F. , Wen, W. , Xu, W. , Yan, J. , Zhang, M.