Solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
PDB DOI: 10.2210/pdb2ad9/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2005-07-20 Deposition Author(s): Allain, F.H.T. , Auweter, S.D. , Black, D.L. , Erat, M. , Hargous, Y. , Henning, A. , Oberstrass, F.C. , Pitsch, S. , Reymond, L. , Wenter, P.
Solution structure of polypyrimidine tract binding protein rbd1 complexed with cucucu rna
Allain, F.H.T. , Auweter, S.D. , Black, D.L. , Erat, M. , Hargous, Y. , Henning, A. , Oberstrass, F.C. , Pitsch, S. , Reymond, L. , Wenter, P.
Primary Citation of Related Structures: 2AD9
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-R(*CP*UP*CP*UP*CP*U)-3' | b | 6 | NA | CUCUCU |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Polypyrimidine tract-binding protein 1 | A | 119 | Homo Sapiens , Synthetic Construct | MGSSHHHHHHSSGLVPRGSHMGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQAR |
Method: SOLUTION NMR
Deposited Date: 2005-07-20 Deposition Author(s): Allain, F.H.T. , Auweter, S.D. , Black, D.L. , Erat, M. , Hargous, Y. , Henning, A. , Oberstrass, F.C. , Pitsch, S. , Reymond, L. , Wenter, P.