Solution structure of a de novo designed single chain three-helix bundle (a3d)
PDB DOI: 10.2210/pdb2a3d/pdb
Classification: THREE-HELIX BUNDLE Organism(s): Synthetic Construct
Deposited: 1999-04-01 Deposition Author(s): Bryson, J.W. , Cheng, H. , Degrado, W.F. , Roder, H. , Walsh, S.T.R.
Solution structure of a de novo designed single chain three-helix bundle (a3d)
Bryson, J.W. , Cheng, H. , Degrado, W.F. , Roder, H. , Walsh, S.T.R.
Primary Citation of Related Structures: 2A3D
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN (DE NOVO THREE-HELIX BUNDLE) | A | 73 | Synthetic Construct | MGSWAEFKQRLAAIKTRLQALGGSEAELAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDELQAYRHN |
Method: SOLUTION NMR
Deposited Date: 1999-04-01 Deposition Author(s): Bryson, J.W. , Cheng, H. , Degrado, W.F. , Roder, H. , Walsh, S.T.R.