The solution structure of jingzhaotoxin-xi
PDB DOI: 10.2210/pdb2a2v/pdb
Classification: TOXIN Organism(s): Chilobrachys Jingzhao
Deposited: 2005-06-23 Deposition Author(s): Liang, S.P. , Liao, Z.
Method: SOLUTION NMR Resolution: N.A.
The solution structure of jingzhaotoxin-xi
Primary Citation of Related Structures: 2A2V
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Jingzhaotoxin-XI | A | 34 | Chilobrachys Jingzhao | ECRKMFGGCSVDSDCCAHLGCKPTLKYCAWDGTF |
Method: SOLUTION NMR
Deposited Date: 2005-06-23 Deposition Author(s): Liang, S.P. , Liao, Z.