Solution structure of rim2 zinc finger domain
PDB DOI: 10.2210/pdb2a20/pdb
Classification: METAL BINDING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2005-06-21 Deposition Author(s): Alam, A. , Dulubova, I. , Huryeva, I. , Lou, X. , Lu, J. , Rizo, J. , Schneggenburger, R. , Sudhof, T.C.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of rim2 zinc finger domain
Alam, A. , Dulubova, I. , Huryeva, I. , Lou, X. , Lu, J. , Rizo, J. , Schneggenburger, R. , Sudhof, T.C.
Primary Citation of Related Structures: 2A20
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Regulating synaptic membrane exocytosis protein 2 | A | 62 | Rattus Norvegicus | GSQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKVMWVCNLCRKQQE |
Method: SOLUTION NMR
Deposited Date: 2005-06-21 Deposition Author(s): Alam, A. , Dulubova, I. , Huryeva, I. , Lou, X. , Lu, J. , Rizo, J. , Schneggenburger, R. , Sudhof, T.C.