Crystal structure of the complex between the c-terminal domains of human xpf and ercc1
PDB DOI: 10.2210/pdb2a1j/pdb
Classification: DNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2005-06-20 Deposition Author(s): Ellenberger, T. , Enzlin, J.H. , Scharer, O.D. , Tsodikov, O.V.
Crystal structure of the complex between the c-terminal domains of human xpf and ercc1
Ellenberger, T. , Enzlin, J.H. , Scharer, O.D. , Tsodikov, O.V.
Primary Citation of Related Structures: 2A1J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA repair endonuclease XPF | A | 63 | Homo Sapiens | MPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVV |
| DNA excision repair protein ERCC-1 | B | 91 | Homo Sapiens | MGSSHHHHHHSQDPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-06-20 Deposition Author(s): Ellenberger, T. , Enzlin, J.H. , Scharer, O.D. , Tsodikov, O.V.