Structure of the yeast yhh6 sh3 domain
PDB DOI: 10.2210/pdb2a08/pdb
Classification: PROTEIN BINDING Organism(s): Grouper Iridovirus
Deposited: 2005-06-16 Deposition Author(s): Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M. , Zou, P.
Method: X-RAY DIFFRACTION Resolution: 1.54 Å
Structure of the yeast yhh6 sh3 domain
Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M. , Zou, P.
Primary Citation of Related Structures: 2A08
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Hypothetical 41.8 kDa protein in SPO13-ARG4 intergenic region | A | 60 | Grouper Iridovirus | GAMATAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRVS |
Hypothetical 41.8 kDa protein in SPO13-ARG4 intergenic region | B | 60 | Grouper Iridovirus | GAMATAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRVS |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-06-16 Deposition Author(s): Kursula, I. , Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M. , Zou, P.