The solution structure of the amp-pnp bound nucleotide binding domain of kdpb
PDB DOI: 10.2210/pdb2a00/pdb
Classification: HYDROLASE Organism(s): Escherichia Coli
Deposited: 2005-06-15 Deposition Author(s): Altendorf, K. , Bramkamp, M. , Coles, M. , Haupt, M. , Kessler, H.
The solution structure of the amp-pnp bound nucleotide binding domain of kdpb
Altendorf, K. , Bramkamp, M. , Coles, M. , Haupt, M. , Kessler, H.
Primary Citation of Related Structures: 2A00
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium-transporting ATPase B chain | A | 156 | Escherichia Coli | MGHHHHHHHHHHSSGHGGRHNRQASEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKG |
Method: SOLUTION NMR
Deposited Date: 2005-06-15 Deposition Author(s): Altendorf, K. , Bramkamp, M. , Coles, M. , Haupt, M. , Kessler, H.