Structural characterisation of an engineered tandem repeat contrasts the importance of context and sequence in protein folding
PDB DOI: 10.2210/pdb261l/pdb
Classification: HYDROLASE Organism(s): Enterobacteria Phage T4
Deposited: 1999-05-11 Deposition Author(s): Baase, W.A. , Matthews, B.W. , Sagermann, M.
Structural characterisation of an engineered tandem repeat contrasts the importance of context and sequence in protein folding
Baase, W.A. , Matthews, B.W. , Sagermann, M.
Primary Citation of Related Structures: 261L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LYSOZYME | A | 173 | Enterobacteria Phage T4 | MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSINAAKSELDKAINAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-05-11 Deposition Author(s): Baase, W.A. , Matthews, B.W. , Sagermann, M.