Solution structure of a219
PDB DOI: 10.2210/pdb1zxg/pdb
Classification: Immune System/Protein Binding Organism(s): Haemonchus Contortus
Deposited: 2005-06-08 Deposition Author(s): Alexander, P. , Bryan, P.N. , He, Y. , Orban, J. , Yeh, D.C.
Solution structure of a219
Alexander, P. , Bryan, P.N. , He, Y. , Orban, J. , Yeh, D.C.
Primary Citation of Related Structures: 1ZXG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Immunoglobulin G binding protein A | A | 59 | Haemonchus Contortus | MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQAPKA |
Method: SOLUTION NMR
Deposited Date: 2005-06-08 Deposition Author(s): Alexander, P. , Bryan, P.N. , He, Y. , Orban, J. , Yeh, D.C.