Solution structure of the subunit binding domain (hbsbd) of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
PDB DOI: 10.2210/pdb1zwv/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2005-06-06 Deposition Author(s): Chang, C.F. , Chuang, D.T. , Huang, T.H.
Solution structure of the subunit binding domain (hbsbd) of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
Chang, C.F. , Chuang, D.T. , Huang, T.H.
Primary Citation of Related Structures: 1ZWV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial | A | 58 | Homo Sapiens | GEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2005-06-06 Deposition Author(s): Chang, C.F. , Chuang, D.T. , Huang, T.H.