Solution structure of a zap1 zinc-responsive domain provides insights into metalloregulatory transcriptional repression in saccharomyces cerevisiae
PDB DOI: 10.2210/pdb1zw8/pdb
Classification: TRANSCRIPTION Organism(s): Saccharomyces Cerevisiae
Deposited: 2005-06-03 Deposition Author(s): Feng, L.S. , Laity, J.H. , Matskevich, V.A. , Parasuram, P. , Venkataraman, K. , Wang, Z.
Solution structure of a zap1 zinc-responsive domain provides insights into metalloregulatory transcriptional repression in saccharomyces cerevisiae
Feng, L.S. , Laity, J.H. , Matskevich, V.A. , Parasuram, P. , Venkataraman, K. , Wang, Z.
Primary Citation of Related Structures: 1ZW8
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc-responsive transcriptional regulator ZAP1 | A | 64 | Saccharomyces Cerevisiae | DLKCKWKECPESASSLFDLQRHLLKDHVSQDFKHPMEPLACNWEDCDFLGDDTASIVNHINAQH |
Method: SOLUTION NMR
Deposited Date: 2005-06-03 Deposition Author(s): Feng, L.S. , Laity, J.H. , Matskevich, V.A. , Parasuram, P. , Venkataraman, K. , Wang, Z.