Structure of the q61g mutant of ras in the gdp-bound form
PDB DOI: 10.2210/pdb1zvq/pdb
Classification: ONCOPROTEIN Organism(s): Homo Sapiens
Deposited: 2005-06-02 Deposition Author(s): Ford, B. , Nassar, N.
Structure of the q61g mutant of ras in the gdp-bound form
Primary Citation of Related Structures: 1ZVQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transforming protein p21/H-Ras-1 | A | 166 | Homo Sapiens | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGGEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-06-02 Deposition Author(s): Ford, B. , Nassar, N.